PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00181.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 587aa    MW: 64397.9 Da    PI: 6.4988
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00181.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.22.5e-16300338240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Rsa1.0_00181.1_g00005.1 300 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 338
                              689**********************************96 PP

2TCR52.41.1e-16385423139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  Rsa1.0_00181.1_g00005.1 385 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 423
                              589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19299340IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.749300425IPR005172CRC domain
PfamPF036386.3E-12302337IPR005172CRC domain
SMARTSM011144.2E-17385426IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.4E-12387423IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MDTPQKTVTQ IETPVSKLKV ENSPVFNYIN SLSPITTVKS TSTAQTFSSL TFTSPPPVFT  60
TPHVVASHKE SRFRSHSNSS DPSKVGPEAS TLEEEEEEEA LLEKEPSQNL KNESVTNDGA  120
CEDVETDLQR MCDDNVKRKS DTPDWETLIS NSSDMLIYGS PNDSEAFRCF LQRSSDSKTR  180
LCSGGSKPAL DPSVSKSNEP ESSDALSILH RGVRRRCLDF EMPRCVVPSI GLHLNAIAMS  240
CKDNNVSKQH SYTGNVKVGL QSSTTPALPS NDIVRESEAR EAVEEAPMRK SEQAGEGESS  300
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CVDCFNKPIH EDTVLATRKQ IESRNPLAFA  360
PKVIRNSDSI TEVGEDASKT PASARHKRGC NCKKSNCLKK YCECYQSGVG CSINCRCEGC  420
KNAFGRKDGS SFAGMDTEQD QENETSGKSG TAIPLPPSTP MSLRQPLSQL PNSSNNMLLS  480
QQSQQHLHGA SGSSLYNNSQ SSFRKQDMSL LSHSRIDTIA EERAEDIEDI ENLIQSPVTN  540
INAVSPNSKR VSLPHMESTE TTPWRRNGGR KLLLSSIPTF PSLTPHH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-159AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-159AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-159AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607445.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X2
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3ABH90.0A0A0D3ABH9_BRAOL; Uncharacterized protein
STRINGBra023810.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein